Products/Services Used | Details | Operation |
---|---|---|
Peptide Synthesis | … acids 7 through 37, HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, HPLC purity 97.9%) used in this study were synthesized by Solid Phase Peptide Synthesis Technology on GenScript … | Get A Quote |
objective: We constructed a recombinant oral GLP-1 analogue in Lactococcus lactis (L. lactis) and evaluated its physiological functions. results: In silico docking suggested the alanine at position 8 substituted with serine (A8SGLP-1) reduced binding of DPP4, which translated to reduced cleavage by DPP4 with minimal changes in stability. This was further confirmed by an in vitro enzymatic assay which showed that A8SGLP-1 significantly increased half-life upon DPP4 treatment. In addition, recombinant L. lactis (LL-A8SGLP-1) demonstrated reduced fat mass with no changes in body weight, significant improvement of random glycemic control and reduced systemic inflammation compared with WT GLP-1 in db/db mice. conclu... More